PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G31960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 132aa    MW: 14425.4 Da    PI: 9.7924
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G31960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.21.4e-1658117160
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                      e+e ++++r++kNRe+A rsR+RK+a+++eLe++v  L +eN +Lk   ++lk e+a+l 
  LPERR02G31960.1  58 EEEERKTIRMMKNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRHCKQLKTEMAALI 117
                      678899***********************************************9999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.0E-1656117No hitNo description
PRINTSPR000411.5E-55773IPR001630cAMP response element binding (CREB) protein
PfamPF001705.2E-1458116IPR004827Basic-leucine zipper domain
SMARTSM003387.2E-1458122IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.50760116IPR004827Basic-leucine zipper domain
CDDcd147071.39E-1462116No hitNo description
SuperFamilySSF579599.0E-1362118No hitNo description
PRINTSPR000411.5E-57595IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.5E-595112IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MAEQLGSPQL SLSSCSSFLS ISSAAADGAP HLSLGAGGGE ELDLLMQVGI GGGGGDEEEE  60
ERKTIRMMKN RESALRSRAR KRAYVQELEK EVRRLVNENL KLKRHCKQLK TEMAALIQPT  120
TKQSSHRRSS ST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0610861e-129AK061086.1 Oryza sativa Japonica Group cDNA clone:006-206-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006648186.11e-55PREDICTED: protein FD-like
SwissprotQ84JK22e-13FD_ARATH; Protein FD
TrEMBLA0A0D9VN607e-91A0A0D9VN60_9ORYZ; Uncharacterized protein
STRINGOB02G45490.14e-55(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.13e-13bZIP family protein